Info Story

Sokka Paanai for Karthigai festival at Shree Maha Mariamman Temple

December 5, 2014 Vel EventsHinduInfo StoryinterestingMurugaPenangTamilVideoWhat's New

Sokka Paanai or "Sorkka Paavanai" is a bonfire grows up to sky level on Karthigai festival day one. Sokka Paanai is event sequence: On the evening of Karthigai day, dried coconut leaves are tied together right in front of the temple. Karthigai prayers will held at temple. A clay pot will be put after the […]

More

48 festivalKarthigailampsmurugaprayersSokka PaanaiSorkka Paavanaitemple

Sani peyarchi 2014-2017 predictions. – சனிப் பெயர்ச்சி பலன்கள் 2014-2017

November 30, 2014 Vel collectionHoroscopeInfo StoryScienceTamilVideo

Sani Peyarchi 2014 for Mesham rasi, Rishabam rasi, Mithunam rasi, Katakam rasi, Simmam rasi, Kanni rasi, Thulam rasi, Viruchigam rasi, Dhanusu rasi, Makaram rasi, Kumbam rasi, and Meenam rasi. மேஷம் ரிஷபம் மிதுனம் கடகம் சிம்மம் கன்னி துலாம் விருச்சிகம் தனுசு மகரம் கும்பம் மீனம்

More

678 2014Dhanusu rasiKanni rasiKatakam rasiKumbam rasiMakaram rasiMeenam rasiMesham rasiMithunam rasiRishabam rasiSani peyarchiSimmam rasiThulam rasiViruchigam rasi

Shree Maha Mariamman Temple, Thimithi Thiruvizha 2014

September 6, 2014 Vel AmmancollectionEventsHinduInfo StoryPenangPhoto Blog

Shree Maha Mariamman Temple Annual Thimithi Thiruvizha held on 6th September 2014 evening. Followings are photos o the event. This is one of the oldest temple in Penang. Previously, part of Alma Estate.

More

1,318 almaammaammanbukit mertajamchariotfire walkingpoojaithimithithiruvila

Penang Hindu Youth Organisation, Ubayam at Shree Maha Mariamman Temple, Alma Bukit Mertajam

August 28, 2014 Vel AmmanEventsHinduInfo StoryinterestingPenangPhoto BlogShaktiWhat's New

Penang Hindu Youth Organisation, alma Branch had Ubayam at Alma Temple by evening on 28 August 2014 . It was a grand events by youths and devotee.

More

50 ammanhyoorganisationprayersthiruvilaubayam

Shree Maha Mariamman Temple Alma, Thimithi Thiruvizha 14 September 2013

July 22, 2014 Vel AmmanEventsfacebookHinduInfo StoryinterestingMusicPenangVideo

Alma Temple Thivizha fire walking ceremony was held on 14 September for the year 2013. This is 1st thimithi after the temple under go some major renovation.     Video courtesy of Suria Production

More

50 annual prayer. ammanfiregodprayershaktithimithithiruvilawalking

Guides on Kamaatchi Amman vilakku or Asthalakshmi vilakku

July 10, 2014 Vel collectionDurgai ammanfacebookInfo StoryKamachi AmmanMahalakshmiMugambigaiMuniswararMurugaScienceShaktiShiva

KAAMATCHI VILAKKU Every altar MUST have a lamp made from brass (vengalam) or now gold coating (plated). This lamp usually a Kamaatchi Amman vilakku or Asthalakshmi vilakku. This vilakku is known as “Nilaivilakku”. It should be placed on a small tray and kept in the middle facing east (very auspicious). You can keep on the […]

More

58 Asthalakshmi vilakkuIndian lampKamaatchi Amman vilakkuPrayer lampSami Vilakku

Tripurasundari – Shri-vidyA

July 10, 2014 Vel collectionfacebookHinduInfo StoryKaliammanMahalakshmiMangalambigaiShakti

“SundarI, the beautiful, is Her name. MahA-Tripura-SundarI or just, Tripura-SundarI , both derived from the root name, SundarI, is the Goddess propitiated by the great mantra called Shri-vidyA. Of the many names of ambaal, such as ParvatI, Durga, KALI, BAlA, BhuvaneshvarI, etc., it is the SundarI name that goes with RAja-RAjesvari, the Queen name of […]

More

36 photoshaktiShri-vidyA

Ponunnjal for Amman

May 29, 2014 Vel AmmanEventsHinduInfo StoryinterestingShakti

Ponnunjal Festival at Shree Maha Mariamman Temple, Alma. Unjal is said to be the time where Amma is in ‘Sayana’ – resting.   карту Займ банковскую на кредит бизнеса собственников дляpkp-partner.ru займы быстро онлайн втб 24 барнаул кредитные карты что такое google adwords скачать plumo накрутка сердечек вконтактевосстановить удаленные файлы с диска свзломать одноклассники бесплатновзять […]

More

35 ammanfestivalponnunjalunjal

Arulmigu Sri Ramalingeswarar Temple, Bangsar

December 31, 2013 Vel collectionHinduInfo StoryinterestingKuala LumpurNandiPhoto BlogSelangorShaktiShivaStatue

A very nice temple at Jalan Marof, Bangsar. Once you go into temple, you can start feel peace and ralax. There are strong vibration at here and feel blessed once at there. Photos of temple as follow…               Best of all, here they keep varies statue of god.   […]

More

36 aumbangsarpeaceprayramalingeswararshiva lingamshiva peruman

The 63 saintly devotees of Lord Shiva

December 7, 2013 Vel HinduInfo StoryShiva

The 63 saintly devotees of Lord Shiva. They are also known as Nayanars. Sundaramurthi Nayanar Tiru Neelakanta Nayanar Iyarpahai Nayanar Ilayankudi Mara Nayanar Maiporul Nayanar Viralminda Nayanar Amaraneedi Nayanar Eripatha Nayanar Enadinatha Nayanar Kannappa Nayanar Kungiliya Kalaya Nayanar Manakanchara Nayanar Arivattaya Nayanar Anaya Nayanar Murthi Nayanar Muruga Nayanar Rudra Pasupathi Nayanar Tiru Nalai Povar Nayanar […]

More

437 devoteedevotionalgurumuniwarNayanarspraythiyanam

« Previous Posts Next posts »

This Velmuruga.com maintaned and managed by M-Rames.