interesting

ஆடிப்பூர திருவிழா – Adipura Vizha, a prayer for Ambal

August 7, 2016 Vel AmmancollectionfacebookHinduInfo StoryinterestingKaliammanKamachi AmmanMahalakshmiMangalambigaiMugambigaiShaktiTamil

“ஆடிப்பூர திருவிழாவும் அதன் மகிழ்மையும்” உலகை ஆளும் அம்பிகை அவதரித்த தினம் ஆடிப்பூரம் ஆகும்.  ஆடி மாதத்தில் வரும் பூரம் நட்சத்திரத்தில் இந்த விழா அனைத்து அம்மன் கோவில்களிலும், வெகு விமரிசையாக கொண்டாடப்படுகிறது. உலக மக்களை காக்க சக்தியாக, அம்பாள் உருவெடுத்த புண்ணிய தினம் இது  என்று கூறப்படுகிறது.  இந்த தலைசிறந்த நாளிலேயே பெரும்பாலும் சித்தர்களும், யோகிகளும் தவத்தை தொடங்குவதாக புராணங்கள் தெரிவிக்கின்றன. ஆடி மாதம் என்பது தட்சிணாயன காலத்தின் தொடக்க காலம்.  நம்முடைய ஒரு வருடம் […]

More

adi masamadi monthadi puramambalammanprayershakti

Seemantham – A Ceremony for Pregnant Women for healthy baby

May 27, 2016 Vel collectionHinduInfo Storyinteresting

Seemantham is a pregnant women’s ceremony performed during the seventh month of pregnancy. The ceremony is mainly followed in south India. It is an ancient ritual celebrated by the pregnant woman’s parents to take blessings from elders for safe delivery. This function marks as a celebration for her fertility. Pregnant woman’s desires will be fulfilled […]

More

7th monthhealthy babyindian eventladiessimanthamvalaikappu

Thulasi – துளசி

July 27, 2015 Vel Info Storyinteresting

துளசி செடி வளரும் இடத்தில் மும்மூர்த்திகளும் சகல தேவதைகளும் வாசம் செய்வதாக ஐதீகம்.இதன் காற்று பட்டாலே பாவங்கள் விலகும் . துர்தேவதைகள்அண்டாது .சீதாதேவி துளசி பூஜை செய்ததன் பலனாக தான் ஸ்ரீராமரை கணவனாகப் பெற்றாள் என்று துளசி இராமாயணம் கூறுகிறது .துளசி செடியை திருமாலின் அம்சம் என்றும் ஸ்ரீ புராணம் கூறும் உண்மையாகும்.பத்ம புராணம் துளசியின் பெருமையை மேலும் விளக்குகிறது. பௌர்ணமி ,ஞாயிற்றுக் கிழமை ,சங்கராந்தி தினம்,நடுப்பகல் இரவு,சூரியோதயதிற்கும் பிறகு,தீட்டு எச்சல் உள்ள நிலையிலும் எண்ணெய் தேய்த்து […]

More

benefitfactsthulasi

Kandha Puranam by Salem Rukmani :: Part 01 to Part 10

January 10, 2015 Vel HinduInfo StoryinterestingMurugaScienceTamilThaipusamVengadachalapathiVideo

Kandha Puranam is one of Hindu religious texts about that talk about Lord Murugar. Following list of video helps us to understand Kandha Puranam with interesting speech by Hindu Religious talk person, Madam Rukmani from Salem, India. This page contains Part 1 to Part 10 … Part 1 Part 2 Part 3 Part 4 Part […]

More

39 greatness of lord murugankandapuranamKandha puranammurugan storymurugar. thiruchenthurSalem Rukmani

The 8 form’s of Kaala Bhairavar

January 9, 2015 Vel facebookHinduInfo Storyinteresting

Kaal Bhairava is an fierce incarnation of Lord Shiva. The 8 form’s of Kaala Bhairavar are as follow… ———————————————————– 1. Asidanga Bhairava – Gives Creative Ability 2. Guru Bhairava – Divine Educator 3. Chanda Bhairava – Gives incredible energy, cuts competition and rivals 4. Kroda Bhairava – Gives You the Power to Take Massive Action […]

More

48 Kaala bairavar

Sokka Paanai for Karthigai festival at Shree Maha Mariamman Temple

December 5, 2014 Vel EventsHinduInfo StoryinterestingMurugaPenangTamilVideoWhat's New

Sokka Paanai or "Sorkka Paavanai" is a bonfire grows up to sky level on Karthigai festival day one. Sokka Paanai is event sequence: On the evening of Karthigai day, dried coconut leaves are tied together right in front of the temple. Karthigai prayers will held at temple. A clay pot will be put after the […]

More

48 festivalKarthigailampsmurugaprayersSokka PaanaiSorkka Paavanaitemple

Penang Hindu Youth Organisation, Ubayam at Shree Maha Mariamman Temple, Alma Bukit Mertajam

August 28, 2014 Vel AmmanEventsHinduInfo StoryinterestingPenangPhoto BlogShaktiWhat's New

Penang Hindu Youth Organisation, alma Branch had Ubayam at Alma Temple by evening on 28 August 2014 . It was a grand events by youths and devotee.

More

50 ammanhyoorganisationprayersthiruvilaubayam

Shree Maha Mariamman Temple Alma, Thimithi Thiruvizha 14 September 2013

July 22, 2014 Vel AmmanEventsfacebookHinduInfo StoryinterestingMusicPenangVideo

Alma Temple Thivizha fire walking ceremony was held on 14 September for the year 2013. This is 1st thimithi after the temple under go some major renovation.     Video courtesy of Suria Production

More

50 annual prayer. ammanfiregodprayershaktithimithithiruvilawalking

Ponunnjal for Amman

May 29, 2014 Vel AmmanEventsHinduInfo StoryinterestingShakti

Ponnunjal Festival at Shree Maha Mariamman Temple, Alma. Unjal is said to be the time where Amma is in ‘Sayana’ – resting.   карту Займ банковскую на кредит бизнеса собственников дляpkp-partner.ru займы быстро онлайн втб 24 барнаул кредитные карты что такое google adwords high class escort скачать plumo накрутка сердечек вконтактевосстановить удаленные файлы с диска […]

More

35 ammanfestivalponnunjalunjal

Arulmigu Sri Ramalingeswarar Temple, Bangsar

December 31, 2013 Vel collectionHinduInfo StoryinterestingKuala LumpurNandiPhoto BlogSelangorShaktiShivaStatue

A very nice temple at Jalan Marof, Bangsar. Once you go into temple, you can start feel peace and ralax. There are strong vibration at here and feel blessed once at there. Photos of temple as follow…               Best of all, here they keep varies statue of god.   […]

More

36 aumbangsarpeaceprayramalingeswararshiva lingamshiva peruman

« Previous Posts

This Velmuruga.com maintaned and managed by M-Rames.